Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575340.1 | internal | 242 | 1-726(+) |
Amino Acid sequence : | |||
WNMHLVGSFFERISNAGRFNEDEARFFFQQLISGVSYCHSMQVCHRDLKLENTLLDGSPAPRLKICDFGYSKSALLHSQPKSTVGTPAYIAPEVLLRKEYDGKIADVWSCGVTLYVMLVV AYPFEDPDEPKDFRKTINRILSVQYSMPENIQISEECRHLISRIFVGDPAQRITMPEIRNHVWFLKNLPADLIDDKMISDQFEEPDQPMQSIDAIMQISPGNSTSAATTLIPRHGAGAWE FG | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 27,472.026 | ||
Theoretical pI: | 5.366 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
Instability index: | 45.267 | ||
aromaticity | 0.099 | ||
GRAVY | -0.251 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.240 | ||
sheet | 0.236 |