Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575342.1 | internal | 167 | 3-503(+) |
Amino Acid sequence : | |||
SKHTKLLRISLKMSLIPRIFGNRRSSSSMFDPFSMDAFDPFRELGFPGSNSGETSAFATTRIDWKETPEAHMFKADLPGLKKEEVKVEIEEDRVLQISGERNVEKEDKNDTWHRVERSSG KFMRRFRLPENAKMDQVKASMENGVLTVTVPKEEVKKPEVKSIEISG | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 13,354.503 | ||
Theoretical pI: | 7.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 49.672 | ||
aromaticity | 0.103 | ||
GRAVY | 0.291 | ||
Secondary Structure Fraction | |||
Helix | 0.405 | ||
turn | 0.250 | ||
sheet | 0.319 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575342.1 | 5prime_partial | 116 | 503-153(-) |
Amino Acid sequence : | |||
TRDLNGLDLRLLHFFLWNSNSEHSVLHRSLNLIHLCILRKSESSHEFAAASLHAMPSVVLIFFLHVPLSADLKNPILFDLHFHFLLLKPWEIGLEHMSLRSFLPVYSSCSKCRGLP* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,354.503 | ||
Theoretical pI: | 7.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 49.672 | ||
aromaticity | 0.103 | ||
GRAVY | 0.291 | ||
Secondary Structure Fraction | |||
Helix | 0.405 | ||
turn | 0.250 | ||
sheet | 0.319 |