Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575344.1 | internal | 222 | 3-668(+) |
Amino Acid sequence : | |||
VNEIVYGAMAAADVQKAVEKEFEMALQDRVMEETKDKKNAVESYVYDMRNKLSDKYQEFVTDSEREQFMAKLQEVEDWLYEDGEDETKGVYIAKLEELKKQGDPIEQRYKENTERGPLID QFIYCINSYREAAMSSDPKFDHIDLAEKQKVLNECVEAEAWFREKKQQQDALPKYANPVLLSADVQKKAEALDRVCRPIMTKPKPKPAKPATPETPSPQPPQ | |||
Physicochemical properties | |||
Number of amino acids: | 222 | ||
Molecular weight: | 25,674.703 | ||
Theoretical pI: | 4.865 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 47.088 | ||
aromaticity | 0.081 | ||
GRAVY | -0.919 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.158 | ||
sheet | 0.311 |