Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575345.1 | internal | 217 | 2-652(+) |
Amino Acid sequence : | |||
EFELSHLETCEVCVGTGAKVGSKMRICSTCGGRGQVMRTEQTPFGMFSQVSVCPNCGGDGEMISEYCRKCSGEGRIRVKKDIKVKIPPGVNKGSILRVAGEGDAGPRGAPPGDLYVYLDI EEIPEIQRDGINLISTVSVGYLDAILGAVVKVKTVEGMTDLQIPPGTQPGDVLVLARKGAPKLNKPSIRGDHLFTIKVSIPKRISVMERELLEELAS | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 23,255.769 | ||
Theoretical pI: | 7.740 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
Instability index: | 24.309 | ||
aromaticity | 0.037 | ||
GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.272 | ||
sheet | 0.221 |