Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575346.1 | 3prime_partial | 109 | 14-340(+) |
Amino Acid sequence : | |||
MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPTDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISRCCYPSALC | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,067.904 | ||
Theoretical pI: | 8.307 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 55.796 | ||
aromaticity | 0.101 | ||
GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.284 | ||
sheet | 0.202 |