Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575347.1	internal	202	3-608(+)
Amino Acid sequence :
VSPMTTEELTLTVKWSGKEHTVRVCGDDTVGELKRRICEVTNVLPKRQKLLYPKVGSKLADDSLLLTQIPLKSSFKMTMIGTVEDDIIVDQVESPDIIDDFEIDQDEAVDVKDKEINKEK LRRRIAQQKIVLRNPCREGKKLLVLDIDYTLFDHRSTAENPRELMRPYIHEFLSAAYAAYDIMIWSATSMKWVELKMGQLGV
Physicochemical properties
Number of amino acids:		202
Molecular weight:		23,196.601
Theoretical pI:		5.533
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23950 24075
Instability index:		34.711
aromaticity		0.059
GRAVY		-0.334
Secondary Structure Fraction
Helix		0.322
turn		0.153
sheet		0.262