Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575348.1 | internal | 134 | 1-402(+) |
Amino Acid sequence : | |||
EDLSGIWSAMASKRILKELKDLQKDPPTSCSAGPVGEDMFHWQATIMGPPDSPYTGGLYLISIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLT DPNPDDPLVPEIAH | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,767.858 | ||
Theoretical pI: | 5.430 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 43.031 | ||
aromaticity | 0.082 | ||
GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.306 | ||
sheet | 0.216 |