Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575348.1	internal	134	1-402(+)
Amino Acid sequence :
EDLSGIWSAMASKRILKELKDLQKDPPTSCSAGPVGEDMFHWQATIMGPPDSPYTGGLYLISIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLT DPNPDDPLVPEIAH
Physicochemical properties
Number of amino acids:		134
Molecular weight:		14,767.858
Theoretical pI:		5.430
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		43.031
aromaticity		0.082
GRAVY		-0.161
Secondary Structure Fraction
Helix		0.306
turn		0.306
sheet		0.216