Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575350.1 | internal | 107 | 3-323(+) |
Amino Acid sequence : | |||
GFSGEKTKKKGVGGRLQMPEEDLVDVKFRLFDGSDVGPFQFSPTSTVAMLKERIVAEWPKDKKIAPKAANDVKLISAGKILENNKTVGQCKTPFGELPNGVITMHAV | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,615.355 | ||
Theoretical pI: | 9.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 30.211 | ||
aromaticity | 0.065 | ||
GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.252 | ||
sheet | 0.224 |