Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575351.1 | internal | 173 | 1-519(+) |
Amino Acid sequence : | |||
TAIEWELDRELLCPICMQIIKDAFLTACGHSFCYMCIVTHLHNKSDCPCCSHYLTTSQLYPNFLLDKLLKKTSARQISKTASPVEQFRHSLEQGCEVSIKELDALLSMLSEKKRKLEQEE AERNMQILLDFLQMLRKQKVDELNEVQHDLQYIKEDLNSVERHRIDLYRARDR | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 20,375.347 | ||
Theoretical pI: | 6.157 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13450 | ||
Instability index: | 42.316 | ||
aromaticity | 0.064 | ||
GRAVY | -0.443 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.133 | ||
sheet | 0.312 |