Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575353.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
NDPATLRQTMEAARNPELMREMMRNTDRAMSNIESSPEGFNMLRRMYENVQEPFLNASTLSGDTRNDVGSNPFAALLGAQGGGQGRQQSNNPPTAGSETTDNLPAPNTNPLPNPWASAGT GAAQANTTARSNTAGDTRAAPLGLGGLASPGLEQMLGGMPDTTSLNQMMQNPAISQMMQSLLSN | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 16,321.788 | ||
Theoretical pI: | 8.295 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
Instability index: | 54.662 | ||
aromaticity | 0.063 | ||
GRAVY | 0.425 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.358 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575353.1 | 3prime_partial | 159 | 478-2(-) |
Amino Acid sequence : | |||
MPPSICSKPGEASPPRPSGAALVSPAVFDLAVVLAWAAPVPADAQGLGSGLVFGAGRLSVVSEPAVGGLFDCCLPCPPPCAPKRAANGLDPTSFLVSPDNVDAFRNGSWTFSYIRLNILN PSGEDSMLLMALSVLRIISRISSGFRAASIVCRRVAGSL | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 16,321.788 | ||
Theoretical pI: | 8.295 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
Instability index: | 54.662 | ||
aromaticity | 0.063 | ||
GRAVY | 0.425 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.358 | ||
sheet | 0.270 |