Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575355.1	internal	116	3-350(+)
Amino Acid sequence :
KSGNVLPETDISGLNFNETELTLGLPGESRKQISGTKRGISDGMELSLGSSTSGERRLEEDHSKIVISTGTKPLSKAQVVGWPPVRSYRKNVIEKCKYVKVAVDGAPYLRKVDLEM
Physicochemical properties
Number of amino acids:		116
Molecular weight:		12,661.296
Theoretical pI:		9.072
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		33.936
aromaticity		0.043
GRAVY		-0.520
Secondary Structure Fraction
Helix		0.276
turn		0.302
sheet		0.224