Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575359.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
CETKTKDNVFVNVVASIQYRALADKANDAFYKLSNTKGQIQAYVFDVIRASVPKLNLDDVFEQKNEIAKAVEDELEKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARMRVAANEK AEAEKILQIKRAEGEAESKYLSGLGIARQRQAIVDGLRDSVLGFSVNVPGTSAKDVMDMVLLTQ | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 20,369.964 | ||
Theoretical pI: | 5.087 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
Instability index: | 24.635 | ||
aromaticity | 0.060 | ||
GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.163 | ||
sheet | 0.315 |