Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575360.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
FYCGAIGGVVMTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPVERMDIGGSVSVSPCSSYQLSPGASYNPSPVSSS IPSPVSSHYVANVQNNSDPNSLIPWLKNLSSGSSSSSSKFPHHLCIPGGSISAPVTPPLSSPTA | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,828.246 | ||
Theoretical pI: | 9.509 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27305 | ||
Instability index: | 64.644 | ||
aromaticity | 0.071 | ||
GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.391 | ||
sheet | 0.179 |