Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575361.1	internal	122	3-368(+)
Amino Acid sequence :
RAITSAYYRGAVGALLVYDITKGQTFDNVQRWLRELRDHADSNIVIMMAGNKSDLNHLRAVSEQDGQNLAEKEGLSFLETSALEAVNVDKAFQTILTEIYHIISKKALAAQEAAATTTLP GQ
Physicochemical properties
Number of amino acids:		122
Molecular weight:		13,392.943
Theoretical pI:		5.547
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11460
Instability index:		40.976
aromaticity		0.066
GRAVY		-0.187
Secondary Structure Fraction
Helix		0.295
turn		0.172
sheet		0.328