Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575362.1	internal	171	3-515(+)
Amino Acid sequence :
AMHSVLIVMALTWLSWFPFFLFDTDWMGREVYHGDPKGEAAEVKAYNQGVREGAFGLLLNSVVLGISSFLIEPMCKWIGSRLVWAVSNLIVFVCMACTAIISVVSISAHTQGVQHVIGAT RSTQIAALVVFSLLGIPLAVTYSVPFSITAELTADAGGGQGLAIGVLNLAI
Physicochemical properties
Number of amino acids:		171
Molecular weight:		18,213.179
Theoretical pI:		5.708
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31970 32095
Instability index:		27.502
aromaticity		0.099
GRAVY		0.856
Secondary Structure Fraction
Helix		0.409
turn		0.228
sheet		0.287