Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575362.1 | internal | 171 | 3-515(+) |
Amino Acid sequence : | |||
AMHSVLIVMALTWLSWFPFFLFDTDWMGREVYHGDPKGEAAEVKAYNQGVREGAFGLLLNSVVLGISSFLIEPMCKWIGSRLVWAVSNLIVFVCMACTAIISVVSISAHTQGVQHVIGAT RSTQIAALVVFSLLGIPLAVTYSVPFSITAELTADAGGGQGLAIGVLNLAI | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 18,213.179 | ||
Theoretical pI: | 5.708 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
Instability index: | 27.502 | ||
aromaticity | 0.099 | ||
GRAVY | 0.856 | ||
Secondary Structure Fraction | |||
Helix | 0.409 | ||
turn | 0.228 | ||
sheet | 0.287 |