Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575363.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
RTHSGKHIRVKKDGAGGKGTWGRWLDTDGESHIDKNDPNYDSGEEPYELVGTAVSDPLDDYKKSVASIIEEYFSTGDVEVATSDLKELGSTEYHPYFIKRLVSMSMDRHDKEKEMASVLL SALYADVINPAQISWGFFMLVESADDLAVDIPDTIDILALFIARAVVDDILPPAFIARARKMLPESSKGIQVLQTAEKSYLSAPHHAELVERRWGGSTHVTVEEVKKRIADLLREYVESG DTAEACRCIRKLEVSFFLS | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 14,796.724 | ||
Theoretical pI: | 10.443 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32220 | ||
Instability index: | 46.546 | ||
aromaticity | 0.129 | ||
GRAVY | 0.260 | ||
Secondary Structure Fraction | |||
Helix | 0.403 | ||
turn | 0.194 | ||
sheet | 0.315 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575363.1 | complete | 124 | 328-702(+) |
Amino Acid sequence : | |||
MIRRRKWLLFFFLHFMLMLSTLPRLVGDFSCLWSLLMTWQWTYQILLISSLCSSHGLWSMTFFHLLLSQEPEKCFQNPPRGYRCCKLLRRAISQLHTMQNLLRGVGVAAPMSLLRKSRKE LLIY* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,796.724 | ||
Theoretical pI: | 10.443 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32220 | ||
Instability index: | 46.546 | ||
aromaticity | 0.129 | ||
GRAVY | 0.260 | ||
Secondary Structure Fraction | |||
Helix | 0.403 | ||
turn | 0.194 | ||
sheet | 0.315 |