Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575364.1	internal	139	2-418(+)
Amino Acid sequence :
NLSLITTAPSVVYRVNCIDGETVECSNPSLLPEPGKRRSIEEPFVKIELLTPKEYIGALMELAQDRRGIFKEMKYITENRASIIYELPLAEMVGDFFDQLKSRSKGYASMEYSFIGYTES DLIKLDILINGDRVEPLAT
Physicochemical properties
Number of amino acids:		139
Molecular weight:		15,729.908
Theoretical pI:		4.773
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		10430 10555
Instability index:		48.096
aromaticity		0.086
GRAVY		-0.168
Secondary Structure Fraction
Helix		0.338
turn		0.230
sheet		0.295