Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575365.1 | 3prime_partial | 121 | 1-363(+) |
Amino Acid sequence : | |||
MVNGSLDRWISHEKEENGLTWLTRQRIISDIAKGLAYLHDECNQKIIHLDIKPHNILLDQNFNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLRSVITEKVDVYAFGIVLLEVLC G | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,832.882 | ||
Theoretical pI: | 6.900 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 27.225 | ||
aromaticity | 0.074 | ||
GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.198 | ||
sheet | 0.248 |