Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU575367.1 | internal | 202 | 1-606(+) |
Amino Acid sequence : | |||
TVVQLLARFYEPTRGRITVAGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYALPDEYVSKDDVIKAAKAANAHEFIISMPQGYDTLVGERGGLLSGGQRQRIAIARALLKNSPIL ILDEATSALDTISERLVQEALDHLMKGRTTLVIAHRLSTVQNADQIALCSDGKIAELGTHLELLERKGQYASLVDTQRLAFE | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,187.045 | ||
Theoretical pI: | 5.456 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 22.804 | ||
aromaticity | 0.054 | ||
GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.178 | ||
sheet | 0.317 |