Acc_NO	ORF type	length	start-end position (strand +/-)
>GU575367.1	internal	202	1-606(+)
Amino Acid sequence :
TVVQLLARFYEPTRGRITVAGEDLRTFDKSEWARVVSIVNQEPVLFSVSVGENIAYALPDEYVSKDDVIKAAKAANAHEFIISMPQGYDTLVGERGGLLSGGQRQRIAIARALLKNSPIL ILDEATSALDTISERLVQEALDHLMKGRTTLVIAHRLSTVQNADQIALCSDGKIAELGTHLELLERKGQYASLVDTQRLAFE
Physicochemical properties
Number of amino acids:		202
Molecular weight:		22,187.045
Theoretical pI:		5.456
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 12950
Instability index:		22.804
aromaticity		0.054
GRAVY		-0.041
Secondary Structure Fraction
Helix		0.327
turn		0.178
sheet		0.317