Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU594242.1 | 5prime_partial | 149 | 1-450(+) |
Amino Acid sequence : | |||
VAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLTPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIAANADGVAEATILDNQIPLTGPNSVVGRALVVHELEDD LGKGGHELSLTTGNAGGRLACGVVGLTPI* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 15,115.566 | ||
Theoretical pI: | 4.973 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 15.859 | ||
aromaticity | 0.020 | ||
GRAVY | -0.104 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.315 | ||
sheet | 0.242 |