Acc_NO	ORF type	length	start-end position (strand +/-)
>GU594245.1	5prime_partial	142	2-430(+)
Amino Acid sequence :
LGLVAVARCAWIRRIAGINSADPPSLPANKGLKKKVLRSLPKFSYTSERSAKFSECAICLMEFVVGDEIRVLPQCGHGFHVGCIDTWLGSHSSCPSCRQIPVVSRCHMCGELPVTSSSSD VRGETAGSRSAPNNYHVNAFLP*
Physicochemical properties
Number of amino acids:		142
Molecular weight:		15,300.510
Theoretical pI:		8.970
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14480
Instability index:		61.277
aromaticity		0.063
GRAVY		-0.015
Secondary Structure Fraction
Helix		0.275
turn		0.310
sheet		0.211