Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU594249.1 | internal | 260 | 1-780(+) |
Amino Acid sequence : | |||
RKYRFKKLVGSPLTQIASVFVAAWKNRHLDLPSDSSLLYEIDDNGFGEGNKKRKQKLPHSKEYRFLDKAAIKQDGLESNVVNKWKLSTLTDVEEVKLLFRMLPIWATTIMFWASYAQSTT FSVSQATTMDRRIGSFEIPPASLTAFFVGSILLTVIFYDRAIVPICRLVANKRHGLTPLQRIFIGLTLSILAMLASALTEVKRLNVAHLNGLTNDPNATIPLSVFWLIPQFLLIGAGEAF TYIGQLDFFLRECPKGMKTM | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 11,154.047 | ||
Theoretical pI: | 10.577 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 32.509 | ||
aromaticity | 0.098 | ||
GRAVY | 0.144 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.314 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU594249.1 | 5prime_partial | 102 | 779-471(-) |
Amino Acid sequence : | |||
IVFIPFGHSLKKKSNWPIYVKASPAPISKNCGISQNTLNGIVAFGSFVSPFKWATFNLLTSVKADASMAKIERVNPMKILCNGVSPWRLLATSRQIGTMARS* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,154.047 | ||
Theoretical pI: | 10.577 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 32.509 | ||
aromaticity | 0.098 | ||
GRAVY | 0.144 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.314 | ||
sheet | 0.196 |