Acc_NO	ORF type	length	start-end position (strand +/-)
>GU594251.1	internal	101	2-304(+)
Amino Acid sequence :
SEKFTPANLNSARGFEVIDNIKTAVENACSGVVSCADILAIAARDSVLLSGGPFWKVLLGRRDGLAANFSGSSNALPAPFDPLNTIISKFQAVGLNLTDVV
Physicochemical properties
Number of amino acids:		101
Molecular weight:		10,584.823
Theoretical pI:		5.051
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		24.282
aromaticity		0.079
GRAVY		0.193
Secondary Structure Fraction
Helix		0.307
turn		0.347
sheet		0.307

Acc_NO	ORF type	length	start-end position (strand +/-)
>GU594251.1	internal	101	303-1(-)
Amino Acid sequence :
TTSVKFNPTAWNLEIIVLRGSNGAGSALLDPEKLAANPSLLPNSTFQNGPPLNNTESLAAIANISAQETTPLHAFSTAVFILSITSNPLAEFKFAGVNFSL
Physicochemical properties
Number of amino acids:		101
Molecular weight:		10,584.823
Theoretical pI:		5.051
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5500
Instability index:		24.282
aromaticity		0.079
GRAVY		0.193
Secondary Structure Fraction
Helix		0.307
turn		0.347
sheet		0.307