Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU594254.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
LSFIKGVVDSNDLPLNVSREILQESRIVRIMRKRLVRKAFEMIQGIALSENRDDYEKFWENFGKHLKLGCIEDRENHKRLAPLLRFFSSQSENEMISLDEYVENMKPDQKDIYYIASDSV TSAKNTPFLEKLLEKDLEVLFLVDPIDEVAIQNLKAFKEKNFIDISKEDLDLGDKNEDKEKEIKQEFGQTCDWIKKRLGDK | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 23,621.691 | ||
Theoretical pI: | 5.133 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 32.486 | ||
aromaticity | 0.085 | ||
GRAVY | -0.641 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.179 | ||
sheet | 0.274 |