Acc_NO	ORF type	length	start-end position (strand +/-)
>GU594260.1	internal	125	3-377(+)
Amino Acid sequence :
ETINDKDRCGQCKGEKVVQEKKVLEVVVEKGMQNGQKITFPGEADEAPDTATGDIVFVLQQKEHPKFKRKGDDLFVEHTLNLTEALCGFQFILTHLDNRQLIIKSQPGEVVKPDQFKAIN DEGMP
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,050.848
Theoretical pI:		5.211
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 125
Instability index:		12.319
aromaticity		0.056
GRAVY		-0.598
Secondary Structure Fraction
Helix		0.272
turn		0.176
sheet		0.224