Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU594263.1 | internal | 157 | 1-471(+) |
Amino Acid sequence : | |||
RKTPHFYTRFLFIMGLSPYTTPADAGVFCVILVNTATSISIVKGMVRSILHVIGINFASWEEYSIEGPLDPFECRGSPSGSYMEEFRSRTPAVRYDSLCISNLPTQECPVCLADFNHDAE INHLSCGHVFHKLCLEKWLKNWNVTCPLCRDYIMPQE | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,854.398 | ||
Theoretical pI: | 6.065 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25940 | ||
Instability index: | 59.229 | ||
aromaticity | 0.115 | ||
GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.248 | ||
sheet | 0.217 |