Acc_NO	ORF type	length	start-end position (strand +/-)
>GU594266.1	internal	131	1-393(+)
Amino Acid sequence :
AEFISTLLFVFTGVGSAIAYDKLTADAALDPAGLVAIAVCHGFALFVAVSIAANISGGHVNPAVTFGLMLGGQITFITGTFYLIAQLLGSTAACFLLKFVTGGLAVPIHGVAAGVGALEG FVMEIIITFAL
Physicochemical properties
Number of amino acids:		131
Molecular weight:		13,192.428
Theoretical pI:		4.888
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3105
Instability index:		26.605
aromaticity		0.107
GRAVY		1.327
Secondary Structure Fraction
Helix		0.420
turn		0.206
sheet		0.328