Acc_NO	ORF type	length	start-end position (strand +/-)
>GU594267.1	internal	104	3-314(+)
Amino Acid sequence :
FHTHPGASEVLLVVQGSITAAFVSSANTVYLKTIKKGELMVFPQGLLHFQVNAVGFNSVAYVFFSSSNPGLQITDFALFANDLSTKLVEATTFLDEAQIKKLKG
Physicochemical properties
Number of amino acids:		104
Molecular weight:		11,223.770
Theoretical pI:		7.027
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 2980
Instability index:		11.181
aromaticity		0.115
GRAVY		0.368
Secondary Structure Fraction
Helix		0.375
turn		0.231
sheet		0.260