Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU594268.1 | 5prime_partial | 145 | 1-438(+) |
Amino Acid sequence : | |||
IIAQLLGSTAACALLEFATGGMSTGSFALSEGVSVWNAFVFEIVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFTGASMNPAVSFGPSLISWTWTHQWVYWAGPLIG GGLAGFIYEFIFISHTHEQIPSGDF* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 15,141.254 | ||
Theoretical pI: | 4.532 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
Instability index: | 19.748 | ||
aromaticity | 0.145 | ||
GRAVY | 0.798 | ||
Secondary Structure Fraction | |||
Helix | 0.393 | ||
turn | 0.276 | ||
sheet | 0.255 |