Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU594271.1 | 5prime_partial | 148 | 2-448(+) |
Amino Acid sequence : | |||
DARKDLGEYWRDVMKDEPMPKAIQHLMPQSHKEIKTDCHKSSFEPIPNVSSYHGDDVVLKQEKDFEPRSNVSSYHDDDVGLKQEKDFEPRPNVPSYHGDDANLKQEKDFEPRPNVSGYHS DDVGLKQEKDFEPRPNVSSYHGNDADLK* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 15,397.078 | ||
Theoretical pI: | 10.137 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 47.122 | ||
aromaticity | 0.053 | ||
GRAVY | 0.490 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.188 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU594271.1 | 3prime_partial | 133 | 48-446(+) |
Amino Acid sequence : | |||
MSQCLKQSNILCLSHIKKSKLIVTNHLLNQFLMYLVIMVMMLFSNKKKISSQGQMYLVIMMMMLVLNKKKILSQGQMYLVTMVMTLISNKKKILSQGQMYLVTIVMTLVSNKKKISSQDQ MYLVTMVMMLISN | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 15,397.078 | ||
Theoretical pI: | 10.137 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 47.122 | ||
aromaticity | 0.053 | ||
GRAVY | 0.490 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.188 | ||
sheet | 0.293 |