Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU594272.1 | 5prime_partial | 192 | 1-579(+) |
Amino Acid sequence : | |||
TMRFKAEQAHGANNGIGIALRLLEPIREQFPTLSYADFHQLAGVVAVEVTGGPDVPFHPGREDKPEPPVEGRLPDATKGSDHLRDVFVKQMGLSDKDIVALSGAHTLGRCHKERSGFEGP WTANPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPAFRPLVEKYAADEDAFFADYAEAHLKLSELGFAEA* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 11,850.428 | ||
Theoretical pI: | 9.244 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 56.218 | ||
aromaticity | 0.076 | ||
GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.295 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU594272.1 | 3prime_partial | 105 | 315-1(-) |
Amino Acid sequence : | |||
MGTRECNNILVRKTHLFHEHVSQVVRAFGGIRQATFNRWFWLVLSARVKGNIRSSGNFNSNNTSQLMEISIRECGKLLPNGLQESESNANTIVCTMCLLSFEPHG | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,850.428 | ||
Theoretical pI: | 9.244 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 56.218 | ||
aromaticity | 0.076 | ||
GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.295 | ||
sheet | 0.229 |