Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GU810519.1 | 3prime_partial | 109 | 2-328(+) |
Amino Acid sequence : | |||
MVGRPCPVTADRSGGVGVLLNQIRLSATDISALASMKKVAKCDTWCELQNPVNHESLNASCARSRQAEGTSAWASRTASPPMLGPWSSAGSGRWPPVPPRGADGPNASP | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,310.672 | ||
Theoretical pI: | 9.243 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22250 | ||
Instability index: | 49.772 | ||
aromaticity | 0.037 | ||
GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.376 | ||
sheet | 0.248 |