| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GU810522.1 | internal | 119 | 2-358(+) |
Amino Acid sequence : | |||
| KTVRSVGPPIPFAGRAGDADVYRISKRLSATDISALASMKNVAKCDTWCELQNPVNHRVFERKLRPKPLGRGHVCLGVTHRVAPPSPRTALGTGGRILASRAPRCAAGPNAIPRRPASR | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,753.702 | ||
| Theoretical pI: | 11.552 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 41.691 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.294 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >GU810522.1 | internal | 119 | 2-358(+) |
Amino Acid sequence : | |||
| KTVRSVGPPIPFAGRAGDADVYRISKRLSATDISALASMKNVAKCDTWCELQNPVNHRVFERKLRPKPLGRGHVCLGVTHRVAPPSPRTALGTGGRILASRAPRCAAGPNAIPRRPASR | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,753.702 | ||
| Theoretical pI: | 11.552 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 41.691 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.294 | ||
| sheet | 0.218 | ||