Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318215.1 | 5prime_partial | 108 | 1-327(+) |
Amino Acid sequence : | |||
AFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNGDKAWDEHWIFWVGPFIGAFIAAVYHQFVLRAGVIKALGSFRSNT* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,745.487 | ||
Theoretical pI: | 9.694 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 23.197 | ||
aromaticity | 0.148 | ||
GRAVY | 0.546 | ||
Secondary Structure Fraction | |||
Helix | 0.398 | ||
turn | 0.231 | ||
sheet | 0.213 |