Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318215.1	5prime_partial	108	1-327(+)
Amino Acid sequence :
AFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNGDKAWDEHWIFWVGPFIGAFIAAVYHQFVLRAGVIKALGSFRSNT*
Physicochemical properties
Number of amino acids:		108
Molecular weight:		11,745.487
Theoretical pI:		9.694
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 20970
Instability index:		23.197
aromaticity		0.148
GRAVY		0.546
Secondary Structure Fraction
Helix		0.398
turn		0.231
sheet		0.213