Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318230.1 | internal | 153 | 461-3(-) |
Amino Acid sequence : | |||
EVKITLALGNSHLSDIRNVDEEMLKMLQENLPWQMENMNTIVDALMDFKTQKNWLLIQGNDSIGKRRLARVMAKSAFGSDGLVLCINMIGKRENSHVELLNKALRNHKNLVVLVEDVDFA DSELLKFLMDAYENGSPGHLFILSMTTDVNDER | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,401.869 | ||
Theoretical pI: | 5.184 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 29.922 | ||
aromaticity | 0.052 | ||
GRAVY | -0.217 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.216 | ||
sheet | 0.327 |