Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318231.1	internal	185	557-3(-)
Amino Acid sequence :
KGYVQLHTTHGDLNIELHCDITPRACENFITLCERGYYNGVAFHRNVRNFMIQGGDPTGTGKGGESIWGKPFKDEVHSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNFKHTVFG MVVGGLPSLSTMEKVPVDDDDRPLEEIKIISVEVYVNPYAELDEEEEKTDPDNKTEDEDSEKVGS
Physicochemical properties
Number of amino acids:		185
Molecular weight:		20,555.641
Theoretical pI:		5.114
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14565
Instability index:		27.082
aromaticity		0.081
GRAVY		-0.574
Secondary Structure Fraction
Helix		0.276
turn		0.270
sheet		0.205