Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318233.1	internal	108	325-2(-)
Amino Acid sequence :
FSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFTRNMLQGKPITVYRGKNRVDLARDFTYIDDVVKGCVGSLDTAKKSTCPGG
Physicochemical properties
Number of amino acids:		108
Molecular weight:		12,041.439
Theoretical pI:		8.934
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15930 16055
Instability index:		21.485
aromaticity		0.130
GRAVY		-0.446
Secondary Structure Fraction
Helix		0.287
turn		0.241
sheet		0.167