Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318235.1 | internal | 158 | 2-475(+) |
Amino Acid sequence : | |||
VFPAKYAMEMSAVVYKNWVFPDQALPADLVKRGVAVEDSDSPHGVRLLIEDYPYAVDGLEIWSAIKNWVTEYCNFYYGTAEEILTDTELQNWWKELREVGHGDKKDEPWWPEMESPEDLI DSCTIIIWTASALHAAVNFGQYPYAGYLPNRPTVSRRF | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 18,226.279 | ||
Theoretical pI: | 4.536 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 58900 59025 | ||
Instability index: | 57.178 | ||
aromaticity | 0.146 | ||
GRAVY | -0.335 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.209 | ||
sheet | 0.266 |