Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318245.1 | 3prime_partial | 173 | 519-1(-) |
Amino Acid sequence : | |||
MEANWREKKGSYRQRLVDSEFFFYDENRNPWRVRVRDCLDSKKMGYDYSPMPTPWRNFKPSRKSTIGKVNTSSLPPVSQVFPLAKMDKPISFSISRPASSRTQTEKDEQEEMLTFNDIKY DDREYIRFDVFLNTDNNVNADELDKVEFAGSYTSLPRVHANHNAAPEGTCPGG | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 20,090.157 | ||
Theoretical pI: | 6.748 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 45.212 | ||
aromaticity | 0.116 | ||
GRAVY | -0.959 | ||
Secondary Structure Fraction | |||
Helix | 0.249 | ||
turn | 0.277 | ||
sheet | 0.191 |