Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318247.1 | internal | 137 | 2-412(+) |
Amino Acid sequence : | |||
AARAGAASTPIGGGRRLNRGQTWVINAPGGTKMARIWGRTGCKFNAAGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCTANI NGECPRALKVPGGCNNP | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 14,249.043 | ||
Theoretical pI: | 9.224 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23990 | ||
Instability index: | 38.733 | ||
aromaticity | 0.073 | ||
GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
Helix | 0.204 | ||
turn | 0.343 | ||
sheet | 0.190 |