Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318256.1 | internal | 160 | 480-1(-) |
Amino Acid sequence : | |||
LRIKPMDDGNARCPMGPKYGALPEEVEPLLQAAHAARLTVSGVSFHIGSGDADSNAYLGAIAAAKEVFQTAAKFGMSKMTILDIGGGFTSGHQFTTAATAVKSALSQHFHDETELTIIAE PGRFFAETAFTLATTIIGKRVRGELREYWINDGLYGSINC | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,066.168 | ||
Theoretical pI: | 5.938 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 28.748 | ||
aromaticity | 0.088 | ||
GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.225 | ||
sheet | 0.300 |