Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318262.1 | internal | 100 | 302-3(-) |
Amino Acid sequence : | |||
VGSVINWNYTRDGKEEIVKAVVEDVDEEKRLVTFRAAEGHVIELYKAFKATVHIETDGENNLVLWTLEYEKQNEDVPEPLSYLQIFLTMTNDVDTHHVNQ | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,589.756 | ||
Theoretical pI: | 4.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 37.552 | ||
aromaticity | 0.090 | ||
GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.150 | ||
sheet | 0.270 |