Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318273.1 | internal | 150 | 451-2(-) |
Amino Acid sequence : | |||
ESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPSVTLIVGDGAAFVKAAQPGYYDAIIVD SSDPIGPAKDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,067.164 | ||
Theoretical pI: | 4.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
Instability index: | 34.253 | ||
aromaticity | 0.107 | ||
GRAVY | 0.235 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.247 | ||
sheet | 0.207 |