Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318279.1	internal	159	477-1(-)
Amino Acid sequence :
GYFVGNPVTFLGEKNYKVPFAHGMALISDELYKALETHCGGEYIDIDPKNSLCLRHVNSFKKVLKGIYQYHILEPVCESISIKVHKSSGQRRSLEGKFEKLKNPSLLPNMKCRDDWWYLS TYWANDNSVQQALHIRKGTIREWKYWNKQLPFTMRINST
Physicochemical properties
Number of amino acids:		159
Molecular weight:		18,587.189
Theoretical pI:		9.318
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		40910 41160
Instability index:		33.428
aromaticity		0.126
GRAVY		-0.542
Secondary Structure Fraction
Helix		0.333
turn		0.245
sheet		0.201