Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318284.1	internal	139	419-3(-)
Amino Acid sequence :
TTNGQESEKTSPRNFGMRNFKYIETIKQALEKECPNTVSCADIVALSARDGLLWLGGPRVEMRTGRKDSKESYLAEVENYLPNHNDSMSSVLSRFQSIGIDTEGTVALLGAHSVGRVHCV NLVHRLYPTVDPTIDPDYA
Physicochemical properties
Number of amino acids:		139
Molecular weight:		15,399.126
Theoretical pI:		5.771
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		37.640
aromaticity		0.065
GRAVY		-0.450
Secondary Structure Fraction
Helix		0.273
turn		0.266
sheet		0.237