Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318285.1 | internal | 130 | 392-3(-) |
Amino Acid sequence : | |||
QRRGTIDDASFCACENTDEPKPELVKPAHLNAFDIISFSTGFDLSGLFEEKIKKREVIFTSKQPAKTIISKLEDVANRLKLKVMKKDGGLLQLEGCKEGRKGVLSIDAEIFEVTPNFHFV EVKKSNGDTI | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,499.510 | ||
Theoretical pI: | 6.933 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 25.112 | ||
aromaticity | 0.069 | ||
GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.208 | ||
sheet | 0.238 |