Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318286.1 | internal | 118 | 356-3(-) |
Amino Acid sequence : | |||
SGQTVIVSGLNPAAILQSTIGGAPPSTAENGHTRKVVPMSKDALQDFMVSIITQKLQDEKQPFYVLDLGEVVSLMDQWNNALPNIRPFYAVKCNPEPSFLSMLSALGSNFDCASRAEI | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,739.423 | ||
Theoretical pI: | 4.902 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 61.915 | ||
aromaticity | 0.068 | ||
GRAVY | -0.015 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.297 | ||
sheet | 0.254 |