Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318290.1	5prime_partial	117	383-30(-)
Amino Acid sequence :
HKIEFKEGPALPVLDQMIEDGKYHGTYDFIFADADKDNYLNYHKRLIELVKVGGVIGYDNTLWNGSAVAPPDAPLRKYVRYYRDFVLELNKALAADKRIEICQLPVGDGITLCRRIS*
Physicochemical properties
Number of amino acids:		117
Molecular weight:		13,344.151
Theoretical pI:		6.326
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17420 17545
Instability index:		52.402
aromaticity		0.111
GRAVY		-0.294
Secondary Structure Fraction
Helix		0.359
turn		0.188
sheet		0.239