Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318294.1 | internal | 204 | 613-2(-) |
Amino Acid sequence : | |||
SNEKTENKLVECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKI DIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,350.267 | ||
Theoretical pI: | 4.745 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 34.211 | ||
aromaticity | 0.118 | ||
GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.245 | ||
sheet | 0.225 |