Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318296.1	internal	138	416-3(-)
Amino Acid sequence :
VAAEVDKEVYDIAWGEAGVFASVSADGSVRIFDLRDKEHSTIIYESPQPDTPLLRLAWNKQDLRYMATILMDSNKIVILDIRSPAMPVAELERHQASVSAIAWAPQSCRHICSAGDDGQA LIWELPTVAGPNGIDPMS
Physicochemical properties
Number of amino acids:		138
Molecular weight:		15,103.954
Theoretical pI:		4.591
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26595
Instability index:		58.408
aromaticity		0.065
GRAVY		-0.065
Secondary Structure Fraction
Helix		0.297
turn		0.225
sheet		0.283